PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00253.20
Common NameJCGZ_07384, LOC105637858
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family HRT-like
Protein Properties Length: 516aa    MW: 57265.3 Da    PI: 9.6778
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00253.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like54.61.8e-17279308231
       HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                    CG+i++ G++C+r+PvkgRKRCeeHKGmRi
  Jcr4S00253.20 279 CGFIMNGGIPCRRPPVKGRKRCEEHKGMRI 308
                    *****************************7 PP

2HRT-like62.18.2e-20344373231
       HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                    CGv+l+dG++C+rqPv gRKRCeeHKGmR+
  Jcr4S00253.20 344 CGVNLGDGNFCRRQPVSGRKRCEEHKGMRV 373
                    *****************************7 PP

3HRT-like48.41.5e-15433462130
       HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                    +CG++l++GsvC+rqPv+g+K C++HKG+R
  Jcr4S00253.20 433 TCGATLGNGSVCRRQPVRGNKKCWQHKGRR 462
                    7***************************99 PP

4HRT-like62.36.9e-20481511131
       HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                    +CGv l+dG +C+rqPv+gRKRCe+HKGmR+
  Jcr4S00253.20 481 TCGVSLQDGFICMRQPVRGRKRCEQHKGMRV 511
                    7*****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MGAGHDSAAV PAVSRLKRED YKRTKHDSQF SKWQVLIGPS DWEDYSQGKE GAARYRVHNL  60
PSSSGPGLYE LGIAISRGTE SRIGRDVSKL DPNDIVVVYL GQADSVRSRL QHYGRSGAHL  120
GNNCANRYWN DSKCEPPQKG SGLFEEIFER GHSIVFRWAS IKDKRSAEKT EALLLDTFDY  180
AWNKGSNGAR RPDDIIQKLS KIASSNSTFS SIAKRILFLS PGRVGIRIEA NKPLSPEKCT  240
IHEEENGKIF LKGIFKFSRS QSRLVSEKCG IDEDFIPRCG FIMNGGIPCR RPPVKGRKRC  300
EEHKGMRIYG SSSSKSIAEG NSHNFPDVHL NSSTHDDQDH TIECGVNLGD GNFCRRQPVS  360
GRKRCEEHKG MRVKRSVSKP IAEEKCHIPS ITLVRSSSGG QTNCNASSEI DSGHRLQFQS  420
SNGSSVDEFL STTCGATLGN GSVCRRQPVR GNKKCWQHKG RRDGCSLSDT AASFSGFDTF  480
TCGVSLQDGF ICMRQPVRGR KRCEQHKGMR VSTSFY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012076893.10.0PREDICTED: uncharacterized protein LOC105637858 isoform X1
TrEMBLA0A067KFQ60.0A0A067KFQ6_JATCU; Uncharacterized protein
STRINGPOPTR_0006s15450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94093139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-123effector of transcription2
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]